General Information

  • ID:  hor005551
  • Uniprot ID:  Q9DGC9
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  gnrh2
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Expressed in the cell bodies of a cluster of neurons in the midbrain tegmentum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDSFEVSEEMKLCETGECSYMRPQRRSFLRNIVLDALARELQKRK
  • Length:  46
  • Propeptide:  MSRLVLLLGVLLYVGAQLSQAQHWSHGWYPGGKRELDSFEVSEEMKLCETGECSYMRPQRRSFLRNIVLDALARELQKRK
  • Signal peptide:  MSRLVLLLGVLLYVGAQLSQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  Teleost species possess three paralogous GnRHs: mdGnRH and cGnRH-II have been identified in tetrapods; sGnRH has no tetrapod ortholog and is thought to be a duplication of cGnRH-II.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9DGC9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005551_AF2.pdbhor005551_ESM.pdb

Physical Information

Mass: 630915 Formula: C235H388N70O74S4
Absent amino acids: HW Common amino acids: E
pI: 6.54 Basic residues: 9
Polar residues: 10 Hydrophobic residues: 13
Hydrophobicity: -74.35 Boman Index: -14501
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 76.3
Instability Index: 9650.65 Extinction Coefficient cystines: 1615
Absorbance 280nm: 35.89

Literature

  • PubMed ID:  11006121
  • Title:  A novel form of gonadotropin-releasing hormone in the medaka, Oryzias latipes.